IGF-II (Insulin-like growth factor-II), Mouse
Insulin-like growth factor 2 (IGF-2) is one of three protein hormones that share structural similarity to insulin. The major role of IGF-2 is as a growth promoting hormone during gestation. It is believed to be a major fetal growth factor in contrast to Insulin-like growth factor 1, which is a major growth factor in adults.
Sequence:
YGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE with polyhistidine tag at the N-terminus
UnitProt ID:
P09535
Source:
Escherichia coli
Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.
Activity:
Measure by its ability to induce MCF-7 cells proliferation. The ED50 for this effect is <6 ng/mL. The specific activity of recombinant mouse IGF-II is > 1.5 x 105 IU/mg.
Purity:
>98% as determined by SDS-PAGE analysis.
Form:
Lyophilized
Storage Buffer:
Lyophilized from a 0.2 μm filtered solution of PBS, pH 8.0.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.
Shipping Conditions:
Blue ice
YGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE with polyhistidine tag at the N-terminus
UnitProt ID:
P09535
Source:
Escherichia coli
Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.
Activity:
Measure by its ability to induce MCF-7 cells proliferation. The ED50 for this effect is <6 ng/mL. The specific activity of recombinant mouse IGF-II is > 1.5 x 105 IU/mg.
Purity:
>98% as determined by SDS-PAGE analysis.
Form:
Lyophilized
Storage Buffer:
Lyophilized from a 0.2 μm filtered solution of PBS, pH 8.0.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.
Shipping Conditions:
Blue ice
Reviews for IGF-II (Insulin-like growth factor-II), Mouse
Average Rating: 0 (0 Reviews )


